ShopDreamUp AI ArtDreamUp
Deviation Actions
Literature Text
Arachnid: Alright, the combatants are set let's end this debate once and for all!
Scorpio: Get your Hacking Fingers at the ready for it's time for a DEATH BATTLE!
Arachnid: Let's get right in!
BLU Team HQ, Random Ass Location
All was quiet within the vicinity of the BLU Team base for not a single riot was stirring, or at least so they thought. Through an empty corridor, a BLU Scout and Heavy were making their way patrolling their domain making sure that no intruders were inside nor out; as the Heavy with a mini-gun at the ready glanced around he couldn't help but feel more tense feeling that someone was watching than the Scout who was casually chewing on a piece of bubblegum, little did they know that someone was watching from the shadows with a pale grin.
Feeling a sixth sense pick up, The Heavy quickly maneuvered himself around and aimed into the darkness to which there was no response, turning around the Heavy spoke "We might be watched." with a deep Russian tone. The Scout gave a smirk from his ally's superstitions "Heh, what? Did all of those sandwiches finally pull a brain-cell outta ya?" he snarkily responded before walking on ahead of the Heavy "Need to stop believing all 'dose Ghost Stories Engie keeps telling ya-" only to then out of nowhere be pulled upwards, gagging into the darkness to the ceiling of the corridor.
Giving off a shocked gasp, The Heavy made his way towards the location The Scout was and looked up to see nothing. His surprise now turned to anger he begun to thrust his mini-gun around the entire area trying to aim a locale on his foe that took away with his ally however his superstitions were to become a reality as he felt a strange tapping feeling on the side of his shoulder, curiosity overwhelming him he willingly turned around only to see a cyan blue, nailed finger from the darkness reach out and surprisingly give a light "Boop!" on the nose before immediately afterwards a snap of the neck killing the Heavy with the screen going dark.
Next the scene is shown to a large computer monitor supposedly in a further location in the base, with a figure typing in keys and commands on the keyboard with the dim light revealing their shape and body: It was a woman which had a protrusion of hair leaning towards the side with a purple highlight at the very end, her fingers had nail extensions alongside a body that had a magenta over-glow to her bodysuit followed with her imposing overcoat. As the flashing of the monitor revealed her face this was indeed none other than the infamous hacker of the gang, Talon and Worldwide hacker of purple, Sombra and it seemed she was very hasty.
The more she typed in the faster time around her grew for it wouldn't be long until bad company arrived when they found out their teammates where apprehended of. With a dramatic stab of a final key she opened her palm as a USB-flash drive formed in her palm, "Data secured, nice one, Sombra." she applauded herself before receiving a call from one of her holographic projections that opened up "Sombra... did you get the intelligence...?" rasped a middle-aged dark man from behind the screen "Yeah, yeah, I did your chores for ya' anyways I'll be there soon to pick up your groceries as we-" before she could finish her smack talk her conversation was ended abruptly as a loud voice boomed through a speaker in the room.
INTRUDER ALERT! INTRUDER ALERT! A SPY IS IN THE BASE!
"Huh, that's strange..." proposed Sombra confused at the situation "I'll speak with you later." before minimizing the window on her holographic unit "Now, I could've sworn I got rid of enough guys to go undetected-" zooming out of the frame it was shown that Sombra was in a room filled with either potentially knocked out or even dead mercenaries on the floor "I think?" rather jokingly; before she could react she felt her hand was empty and saw that her data was now missing from unknown circumstances.
Immediately after trying to figure out what was going on around her, a kick was felt on her stomach as she was pushed aside by an invisible force "Pardon me..." spoke a French accent from the darkness. The voice began to form itself from underneath it's invisibility before Sombra's eyes: He was leaned, tall and his face was covered by a fitting mask alongside a stylish tuxedo of brown, taking a step forward and fastening his collar he was not like the BLU mercenaries rather of the RED and more specifically he was referred to simply as The Spy. "Looks like I've found my culprit. I don't suppose you have what's mine?" remarked Sombra which went unaffected to the Spy who simply raised himself upright "Oh, you mean this?" he remarked pulling out the USB stick from underneath his blazer with a small smirk drawing on his face while doing so."
Giving a somewhat annoyed look, Sombra replied "I don't suppose you could be a Gentleman and give it back to a dainty lady like myself." she smiled playfully whilst holding her ground "I'm afraid not, mademoiselle" The Spy spoke placing the data back into his pocket "Within the passing moment I should be off, wouldn't want to disrupt the flow of this dispute now would I?" beginning to turn around and make a break for it, The Spy heard a clicking sound from behind him as Sombra brought out from behind her a loaded SMG "Sorry, but I'm not leaving this place without that Intel." she hissed in a Spanish tone.
"I tried going the easy way around." responded The Spy to himself "Now I'll have to settle things the hard way." pulling out a Revolver The Spy straightened his tie with his open hand and braced himself for his opponents next move "Let's have a competition, the one who offs each other first wins!" Sombra teased as she threw her own free arm up as her fingernails glittered with code and numbers spewing from her tips as she threw her foe a dangerous smile "Challenge accepted, let's settle this like Gentlemen!" remarking in a final tone.
And when the alarm went quiet, the battle was to commence in silence, nothing more, nothing less.
Spy made the first move with a straight shot of his revolver but with quick reflexes Sombra sidestepped from the bullets co-ordination and fired off her own shots from her SMG unloading a wave of bullets onto Spy. The Spy's quick mind managed to have him evade most of the shots being thrown at him managing to make to the side of the room, pulling out his revolver once more he shot at a clear angle towards his opponent with quick succession whilst evading the currently incoming shots overhead.
Sombra didn't move as she unfortunately paid the price by being narrowly shot in the shoulder. Shrugging off her graze she began to switch up tactics and began to pursue The Spy who was making a break for the exit from the room "Oh no you don't!" she remarked before beginning to pick up her pace against her opponent; taking note to this, The Spy begin to slowly disappear into thin air by activating his Invisibility now completely out of sight, Sombra took note to this and remarked "You know, you're not the only one who can play that game you know?" suddenly from the back of her head she felt three bullets skim through her head from behind, realizing the sitting duck she was Sombra began to make a dash towards The Spy who was on a platform in the room from where she was from and made a dash for him whilst toggling her Thermo-camo bolting away out of sight.
The Spy now seeing his opponent had disappeared led him cautious to wherever she might be. Out of the corner of his eye, he could see Sombra's pixel-like outline pop into view for a few seconds before taking a few shots towards that location with no effect; making sure to keep himself moving, The Spy tried maneuvering himself in a different spot similar to his competitor trying not to make himself a target, with a few shots more Spy had himself against a wall beside a nearby corridor of the room making sure not to make any noise and not make himself noticeable by blending into the dark.
All was quiet for a brief moment in the untouched scenery. The Spy gave a brief look out of where they both quarreled to pinpoint her location, seeing nothing The Spy returned to his position but not before a tapping on his shoulder was heard and with a quick "Hola!" Spy was smacked to the ground by a newly appeared Sombra who was behind him the entire time, not wanting to waste any time she aimed her SMG to the spot where Spy was lying on "Alright, got ya' cornered. Now hand over that data and nobody gets harmed 'kay?" with an reach of her hand she expected Spy to give her the Info whilst at gunpoint no doubt but Spy had different ideas "Sure thing- Over my dead body first!" and with a quick sweep of his leg and a jab to the stomach Spy had thrown Sombra off-guard and began to make his way once more.
"Gah! Hey, no fair!" Sombra mocked irritated as she continued her pursuit after him. Whilst on the move, Spy had reloaded his revolver to make sure he was ready and was about to make another shot at Sombra before out of nowhere strange strands of pink began to lock themselves around his weapon suddenly a virtual skull appeared above his revolver. Unsure of what this meant, Spy darted into the next room of the facility and tried firing his gun once again to try and get Sombra off his lead but with a silent click it turned out Spy's gun was locked and in doing so threw his weapon to the ground and reached for another from within his blazer.
Sombra smiled as she retracted her hand from where the pink strands had originated from and gave a quick grin "Your toy not working?" she joked as Spy quickly halted and threw his new weapon onto the field: The Ambassador "Hardly." Spy remarked as he got into a straight pose and began firing straight at Sombra's direction. Reacting to the bullets, Sombra switched to her invisibility mode and began to sprint at much faster speeds, speeds much faster than when Spy could fire.
Trailing around her opponent, Spy was starting to run out of bullets and the tension was spiked once that Sombra had gone invisible "Playing Hide and Seek won't help you this time." giving a hefty laugh, Spy also turned invisible leaving a supposedly empty room with only the fast sound of feet echoing over. Then a gunshot was heard and then another following on with a blazing fire of bullets to which following up to the sound of one rolling to the side and then finalizing with a screech of heels with the sound of feet coming straight for one another. With a violent push, the two combatants were finally revealed with showing Spy trying to jam his now appeared Butterfly knife to a resisting Sombra who then managed to break from his grasp and kick him away.
Rolling over and managing to stabilize himself, Spy wiped a bit of blood spewed from the edge of his mouth with his hand and resumed combat to which Sombra continued hers. In a flash of opposing colors Sombra tried going in for a swift chop but Spy countered by grabbing her arm and went for a stab in the stomach to which Sombra grabbed, swept her leg under his and threw him over head to which Spy counteracted and used her weight against her throwing her to a nearby cargo crane in the middle of the room.
Dusting himself off, The Spy began to make his way towards Sombra who was still recovering from the blow and pulled out his Ambassador "Well, it's been a nice distraction but I've got to make my way. Well, not until I've taken care of you first." starting to point to gun close to her head with a soulless frown, Sombra began to retaliate with her own attack. Locking her hand onto the side of the crane, pink veins overtook the machine as it started moving on it's own with its cargo still attached and rising it over her opponent's head to which Spy looked up "I don't think our paths have yet to end yet, amigo." by finishing those words the crane dropped a large crate heading straight for Spy but in quick reaction he evaded the exploding cargo by diving for cover causing the Data to drop from his pocket.
Taking this to her advantage, Sombra let go of the machinery and made her way for the Intel managing to pick it up whilst making her way "Thanks for the Data!" she leapt making her way to the next labyrinth of corridors and rooms. The Spy took account to this and quickly picked himself up following behind her footsteps not long afterwards; finding himself through the twists and turns of his opponent in another cargo-based location filled with crates, The Spy readied himself with knife and gun at the ready to bring back what was rightfully his "I know you're in here" he proposed pulling the safety lock "Come on out and bring that information back with you."
"Sure thing." replied a voice from above revealing to be Sombra from on top of a large platform beginning to hack away at another machine which was located to a wrecking ball "After I take it to Talon first!" and with the press of one final button the device did its work as the wrecking ball was on a collision course not only for the crates but for Spy as well. Making his move in an orderly fashion, Spy managed to mostly avoid being smashed by the heaping ball of iron by hopping and rolling under boxes whilst Sombra stood there and gave a short laugh and momentarily gain her attention for the Data; managing to reach a large enough box to where the ball was headed for next and with a leap of faith he latched himself onto the chain, spun himself around and downright threw himself towards Sombra who gave a confused cry before being pelted upon by a new weight.
Now literally on top of his adversary, Spy began to wrestle Sombra for the USB even to go so far as to stab at her, but Sombra managing to use Spy's weight against him kicked him off onto the control grid of the wrecking ball, causing it to fly high up into the air and start to throw itself at the two at immense speeds. Realizing this, both fighters recovered and began to make a break for it as they flung themselves off the platform dramatically as the heap of iron created an explosion which leveled the entire room with the two landing on the last of the remaining crates in a frenzy of wood and fire.
Spy was the first to recover and began to look for the Intel among the rubble with currently no result, however looking up not only did he get a well deserved punch to the face but to also find Sombra who was up once again have the Data once more "Sorry about going overboard but I gotta get going, don't forget our competition!" she remarked before throwing herself clear beginning to make her way to the next room "Not without a little punishment you're not." Spy replied for as her back was turned he took a clear shot of his Ambassador and shot her square in the side of the stomach causing her to cry out.
"Aah! We haven't been physical in a while, huh?" she remarked, wounded but soldiered on through the next hall. Spy quickly managed to pick himself up as well from a blow as such and began to make chase trying to make another shot in the progress, Sombra took this into mind and turning herself around whilst running she began to unload with her SMG whilst making her way to the next room leaving bullets trailing so that Spy could follow on just as well. As Spy was making pursuit he had analyzed Sombra's way of fighting and from behind his back he grabbed his signature Sapper "Let's see how well your toys do you now." and upon throwing it electricity sparked upon it as it landed loudly in front of Sombra causing her to burst out in pain as she was forcibly pinned to the floor by the Sapper's EMP waves causing her to drop the Data in the progress.
Taking her downfall to his advantage, Spy made his way in the corridor for the Intel which was still grounded on the smooth floor but Sombra wasn't going to let him get away that easily for even whilst she was bound to the floor from the Sapper she threw an arm out which caused Spy to trip up and throw the USB further away than anticipated. Drawing his attention to Sombra, Spy pulled out his Ambassador and tried firing multiple shots towards Sombra to throw her off, however this worked to Sombra's advantage all too well as she evaded the shots in perfect time as they all directly hit and ricocheted off the Sapper with one bullet barely scraping Spy's cheek, the next thing he knew he was overpowered as Sombra punched him off and kicked him away for good measure managing to secure herself and the Data all at once "Gracias!" She replied making her way once more.
But The Spy wasn't one to give up that easily and with a quick dash he was following right behind on Sombra right into the next room; an elevator was shown in this spacious area following with somewhat of a ravine to follow beside it for as both combatants made their way in it was all or nothing this time around. Spy fired from his Ambassador but Sombra's speed gave her boost she needed to avoid the incoming blow and counter with a spurt of her SMG for good measure "Let's be honest here, all this time we've been running around in essentially a circle." she joked with her foe unleashing more shots at the whim.
"Agreed, but it seems you are the one who did all the running." Spy spoke calmly while evading any incoming fire with a straight face, both corners were almost tied with their offense and decided to switch tactics by quickly darting towards one another and locking both in a punch to which they lost their weapons in the quarrel and of course causing Sombra to drop the USB in the process. Now both tied in combat, Spy proposed a new means of fighting as he once again brought out his trusty Butterfly knife "If guns won't settle this match then let's settle this like Gentlemen!" throwing himself into a fencing stance, Sombra agreed "If that's how you want to play it then I'll join in! Winner gets all." before receding herself into a defensive pose. The two locked eyes as the Info laid on the floor both right in front of them.
It was all or nothing if this mission was going to be a success or a failure.
Propelling himself forward, Spy went for a swing of his trusty blade before Sombra retaliated with locking the stabbing arm and throwing multiple jabs into his exposed stomach with damage being noticeable "Ack!" sputtered The Spy before disarming her with a bop to the jaw which made Sombra flinch. However she wasn't finished yet as she brought another punch colliding straight to Spy's jaw before finishing off with a hasty overarm throw by the tie. Managing to recover from the blow the two resumed their fighting stances before going at one another once again.
Two two threw a blow at one another to with the other threw off and countered with another for this cycle continued until Spy broke this chain by delivering a quick thrust of his knife at Sombra's chest causing her to bleed out before giving a harsh roundhouse kick to boot her away giving him enough time to pick up his Ambassador and making his hasted way continue the fight, Sombra managed to pull herself up and become invisible just before The Spy had unleashed a shot from his cartridge giving her more than enough space to pick up her fallen SMG and give Spy a good invisible kick to the back of the head causing him to fall over as a result.
"Had enough?" Sombra snarkily retorted throwing another kick to which Spy surprisingly caught with a clenched hand "No. Far from it in fact and not without that Data no doubt." before forcibly back-flipping her into the air and causing her to harshly connect with the floor. Sombra got up to see that Spy was already upon her and with a broad stance he kicked Sombra right in the face again, and again, and again until throwing her near the edge of the long fall of the HQ whilst wiping blood from underneath his mask "Your little copy-cat games are over. That Intel is mine and that will be the end of it. Also, promise not to bleed on my suit and I'll kill you quickly." narrowing her nearly off the edge with nowhere left go go now leaving her at The Spy's aim.
"Any last words?" Spy asked Sombra politely as he trailed his Ambassador closer to her forehead "Only one..." he spoke as her hands began to emanate pink veins onto the floor before replying with a nifty "EMP Activated." as all of a sudden, a wave of magenta overtook the vicinity and covering Spy entirely for from the moment he tried shooting his weapon had already been locked down causing a sense of surprise to flow through his mind "What the Hell?" he remarked, then all of a sudden he felt a sharp sense of electricity behind and in front of him as his Sapper and Invisibility cloak began to spark and sputter wildly causing an immense pain for The Spy. Sombra took this to her advantage with a grin and with a slick upper-cut Spy was on the floor writhing in pain.
Now with the cards stacked against him, Sombra took this to her advantage. Walking over to her supposedly defeated foe within the given time-frame, she gave a slow walk up to The Spy who was still recovering from his shock "Heh. It was fun playing your game, Amigo." she remarked once more looking at Spy's defeated body "Now. Now you're playing my game." and aiming her SMG straight at Spy's face "Mon dieu." replied Spy before loud shooting flooded the area as Sombra shot multiple rounds into Spy's face before finishing it off silently, with a subtle amount of bullets within his head and a drop of his iconic cigarette from his mouth The Spy was now more than logically dead.
"Whew. That was barely a challenge." Sombra grinned albeit a bit wounded herself. Tending to her wounds she opened up her virtual contact once more and not long afterwards received a call from the same middle-aged voice "Sombra... did you get Intel?" he replied in a croaked tone "Not as of now, but I did have to go heck and back fighting with some guy in a suit." she responded to the hexagonal black screen; though she didn't recognize, The Spy's body had now vanished completely leaving no trace of him behind and a couple of moments later, silent footsteps began making their way towards Sombra making sure not to leave any indication of their position, it was then Sombra began to pick up bad signals "I'll speak with you later." glancing around she gave a suspicious look before returning her attention to the Data "Now where did that Intel go to?"
"Right behind you." spoke a familiar voice for before Sombra could react she felt a hash thrust of a blade on her shoulder only barely missing her back giving a pained grunt in doing so "Ngh- I knew it was too good to be true!" she glanced around The Spy had appeared with a loud uncloaking noise trailing on afterwards for he was once more holding his Ambassador and a strange golden watch known as The Dead Ringer "Really helps you in those scenarios when you don't feel like dying." referring to the watch and tucking it in his pocket, The Spy took his chance to jump the wounded Sombra and shot at her in the chest three separate times over before finishing up the combo with a well-placed kick to the face, causing Sombra to drop something flat that skidded to the far side of the room.
Not wanting to waste any time, Spy began to fasten his tie and loosen his collar in a tidy fashion while Sombra was subdued on the side with his butterfly knife still lodged within her shoulder "Nothing personal, c'est la vie, mon ami." for within the next shot to the arm Sombra was thrown off the edge of the room down into the pit below following with a quick cry not far behind "All to easy." Spy remarked to himself now turning his attention to the location of the Intel and managed to light himself another cigarette as well for good measure. As she was making her descent into the pit, Sombra whilst wounded managed to strike her hands on the side of the pit as purple veins began to make their way to the bottom searching for anything that could be used to aid her.
From out of the dark a large mechanical shaft began rising from the command of the falling Sombra who managed to position herself and within moments began to run up the extending arm of the crane bringing her closer to the top where Spy resided; fingers skimming at the wall again, Sombra then landed on another more larger crane bringing her higher to her intended destination. The Spy quickly noticed this from the incoming sounds and turning around he was surprised Sombra was still up and jumping her way back to the ledge, taking note to this Spy tried taking a few shots at Sombra who managed to hack into the largest crane in the pit giving her enough time to parkour and evade Spy's bullets which bounced off the metal of the machines.
"Here goes nothing!" Sombra threw herself off the largest crane and made a leap of faith into the air but not long afterwards her entire form vanished within an instant in a purple gaze. The Spy was left alone in the room and took a few steps back towards the elevator with the USB in hand as the crane's slowly descended down towards the pit, then from the corner of his eye from his left Spy saw that the device his opponent dropped began to flash in a brilliant flash of pink and almost immediately Sombra reappeared from the device with a fist at the ready punching Spy so hard that he made a full-looped back-flip with Sombra skidding to a halt on her heels.
Making a sharp turn behind her, Sombra managed to yank Spy's butterfly knife out of her shoulder and held onto it for possible later use. "Well, I shouldn't expect less from someone who relies on machines for their own aid." Spy snorted in a French accent who upon picking himself up began to disappear into thin air once again leaving Sombra a potential sitting duck, but instead of a tense look Sombra just smiled as she viewed around her surroundings "You want to know how I've been able to track you all this time?" Sombra questioned Spy who was about to land a shot from behind her back with his Ambassador "I could just keep track with you." Sombra answered as she swung around and fired her SMG in a straight pose within Spy's direction landing a near direct hit near his legs.
Giving a grunt of pain, Spy's invisibility quickly subsided as Sombra threw a quick jab at Spy following with a quick spin-kick in the air trying to make a collision with Spy's chest, however the latter managed to latch hold of her foot before connecting and managed to evade the strike by sending her overhead but Sombra managed to recover from this assault and edged her leg around Spy in a 360 degree motion managing to sweep Spy up in the process, quickly raising herself upwards she grabbed Spy by the collar and threw him near a set of crates near the elevator in quick succession.
Sombra made a head-start towards The Spy in quick haste, however he had another trick up his sleeve and tried using Sombra's tech against him with his Sapper but with a quick "Not this time!" pink threads begun to lace around the device for in quick progression the Sapper was deactivated ultimately becoming useless with a pink skull hovering above. Before he could react to his foe, Sombra already ran beside him and sprung up to the wall behind him, springing her foot off she darted towards Spy and unleashed a well-placed propelled kick to Spy's face causing him to grunt in pain with the whiplash throwing him to the side nearing the elevator.
Taking her chance, Sombra took this opportunity to shove her and Spy into the lift and within moments the two were being raised into the air at high velocities.
The two in the enclosed space gave a final glance at one another both with sharp looks in their eyes "Gotta admit, this is the most fun I've had since." Sombra grinned as she threw herself into a fighting pose "Then I'm sorry to be the one to rain on your parade." The Spy remarked before being the one to throw a fist, managing to lock on upon this incoming strike, Sombra redirected herself and tried going in for defensive block to which the strike was sealed. The Spy tried changing up tactics and with with a swift axe kick he broke Sombra's pose momentarily stunning her before trying to fire with his Ambassador in point-blank range.
Retaliating, Sombra threw out her SMG and fired alongside with the two fighters locked in a close-handed brawl as they ascended higher in the elevator. From the bullets firing at one another the two had gone bone-dry with their guns; being the one who needed to reload quick, Sombra tried filing another cartridge into her SMG as quick as possible, but Spy was already upon this and took this chance to jump her while vulnerable managing to throw in a few good-old fashioned combos, but Sombra was sharp to react and managed to try kicking him back to his side of the elevator door but throughout the quarrel this led her to drop The Spy's butterfly knife in the process of defending herself.
As Sombra began to regain her stance "Rule number one of Defense: Never let your guard down!" The Spy now armed threw his arm at Sombra to which she managed to graze her arm "Argh!" cried Sombra trying to evade the next strike afterwards. With another slice, Sombra tried maneuvering herself at a swift motion around the enclosed space, but in the blink of an eye Spy grabbed Sombra by the scruff and managed to pin her to the floor, despite struggling this all seemed like child's play for The Spy as he brought his knife over Sombra's throat with a soft laugh "A quick reminder that this will be the last time you see me." Spy laughed again with Sombra's mind racing for a backup plan.
Then it hit her, slamming her open palm onto the ground for the last time the purple veins began to cover the brim of the elevator and almost immediately the machine screeched to a halt. Due to the momentum, The Spy was thrown off Sombra which gave her all the time she needed to kick Spy off and land on the front-side of the lift "Well played..." rasped Spy; picking herself up, The Spy spat and went for a forward punch towards Sombra's face however the latter reacted just in time to hold onto the arm and shot at Spy's stomach with her now reloaded SMG dealing critical damage on her opponent.
Beginning to cough up blood, The Spy went for a final all out attack with a violent flurry of strikes with his blade, but it was all too easy for Sombra as she latch a hold on the knife and in retaliation threw a slice on Spy's now torn suit "You know." Sombra spoke ready to cover up her one-liner following with another slice "I think red suits you better than brown." and with a lunge, Sombra had impaled Spy with his own knife square in the chest with time around them almost freezing for a split second before returning to the present time. Now simply standing with a blade now stuck in his body, Sombra gave a few steps up towards him finishing off with a signature "Boop!" on the nose before Spy fell off of the elevator almost instantaneously and with a loud smack and wallop, The Spy was now underneath the lift's landing space trying to get up in a painful manor.
Running her fingers through the machinery, Sombra operated the elevator with the pink veins on it glowing wildly "Going down!" then with a final press of a button, the elevator started to drop wildly heading straight for Spy. Recognizing the danger he was now in, The Spy slowly tried reaching into his pocket to grab for the Dead Ringer within his blazer, the faster the lift dropped the more desperate Spy became to grab the piece of equipment and in that moment The Spy managed to pull the golden watch out and embraced for the worse, however, something wasn't right for The Spy as his peril grew closer for he didn't feel his body double forming and looking on the back of the watch he saw the one symbol that put a state of dread into his soul: It had been hacked while he wasn't looking "Oh, merde...." remarked The Spy unimpressed one final time as he looked up. "Adios!"
With a loud crunch, The Spy's entire upper torso was crushed underneath the sheer weight of the elevator with his legs sticking out comically from the front of the elevator with blood flying everywhere, with a final twitch of his feet The Spy was finally dead. "Checkmate. also, ew, French guts." spoke Sombra in a disgusted tone as she stepped off the transportation shaking her leg wildly to throw off the red on her bodysuit; looking around, Sombra began to wonder "Now, where did that Intel go?" she looked around trying any leads before spotting an iconic pink piece of technology lying beside the unfortunate fallen body that was The Spy.
"There we go!" she spoke in a cheery, Spanish tone using two fingers to pick it up and wiping off any excess blood from the drive "Now that's how you deliver Information" she joked to herself before an incoming call awaited her to which the raspy voice returned in the black screen "Sombra... what is your status?" the voice wondered on the other side "Bloodied, a bit beaten up and made some French wine. Ya' know the usual. Also guess what I've got?" she joked and showed the USB drive tauntingly to the voice who was left not amused by this fact.
"If that's the case... report back to base, stat." he growled before cutting off the conversation to which Sombra simply smiled "I'm already on it. Boop!" she replied with a smile on her face before fading into the scenery once more. As the battle drew to a close the base grew quiet once more the room the two combatants did battle in grew silent to the constant whirring and beeping of code and data on the computers not too far away for while one opponent had been successful in their mission the other was left in the dust and it wouldn't be long until reinforcements were to arrive from the BLU Team to try and sort out what happened this day and try and figure out how to retrieve all their secret files back from this mysterious force.
Meanwhile on that hand what were they to do about the mess?
Scorpio: While people prefer their wine strong, I for one prefer mine flat. Also, Arachnid, we've got some serious explaining to do.
Arachnid: Because of Spy's arsenal and skill he was able to hold on despite Sombra's advantage in tech, speed and even experience. See while Spy is generally a seasoned fighter in combat he best utilizes this by fighting behind the sidelines not usually being the physical attacker unlike Sombra who could switch tactics whilst fighting in the front and back of combat without any real difficulty. Another thing to note is that Spy's Revolver and Ambassador are only good for direct hits and kills for when they're used otherwise for any other purpose they can leave Spy quite helpless unlike Sombra with her SMG.
Scorpio: Even when it came to Spy's invisibility while useful it could just be countered with Sombra's Opportunist which if dealt enough damage she could just keep on shooting The Spy even whilst cloaked and believe me with that SMG it would've given her more than enough of an opportunity to get a good hit on Spy and even greater.
Arachnid: Next comes the Dead Ringer, while it does help Spy when he's in a pinch it would only be a matter of time until Sombra could just hack into it and deactivate its usage from there making most of his cloaking choices limited and don't even get us started on the EMP which would most likely disable most of Spy's gadgets there and then (To also keep in mind Ultimate timing is purely game mechanic and Sombra would be able to access it in any probable time alongside her own Invisibility)
Scorpio: Then there comes the one question that perks most of the Spy's equipment: Could the Sapper ultimately stop Sombra? In some situations, yes, if Sombra couldn't just counter with her likewise Hack and EMP which she could do with little trouble, with all those advantages taken from him The Spy is ultimately a sitting duck, heck not even his disguises could do anything to Sombra due to her Opportunist ability ultimately rendering most of his tech helpless.
Arachnid: When it comes to experience, we're exactly sure how long both contenders have been in the fields of stealth, although at the current time Sombra takes that regard for after the Omnic Crisis she was able to hack any computer or program as a child no doubts and dealt in dealing trades and illegal activities with gangs and criminals, so whilst this isn't exactly a combat experience feat this definitely makes Sombra more experienced in strategy and quicker reactions.
Scorpio: Not mention when it came to Speed, Durability and Strength all summed up into Hand-to-Hand, both are equally just as cunning, skilled and deadly with Spy's Butterfly Knife and Revolvers to Sombra's Hacking and SMG but in the long-run Sombra would ultimately take this department to seeing as she's just as and above quicker than Spy giving her enough time to react, shoot and repeat and keep in mind TF2 is very inconsistent with it's speed limitations. It's also worth mentioning that while Spy can go Invisible, Sombra can Teleport giving her another edge in maneuverability.
Arachnid: It's true, Sombra's Translocation means it would give her the leg-up she would need to bring her back in the game just as well as Spy's invisibility does.
Scorpio: And before you say "Ouh, but a whole bunch of spies culd obliterat somber wit god player" or "nu gaem mechs wuld keel somber" Wrong, all wrong. Please, for my sake alone don't argue with that point, don't mortally wound meh. OH G0D, 1t spruding!?
Arachnid: The Ultimate Decider of this battle is that while Spy is the arguably smartest on his team going around the world for his great skills and feats, keep in mind, he's usually a team-player and when the moment is right he plays his opponents into unwinnable situations and exploit their weak points whilst always watching from the Shadows waiting for the right moment and its also worth mentioning that most of the people who fight against his side are morally insane, fueled by bloodshed or even egotistical drunks, meanwhile, Sombra plays the stealth game of manipulation and still fights up close giving her more than enough to play the cards against The Spy.
Scorpio: To shorten things up in Good-old Scorpio fashion: Sombra ultimately had what The Spy just lacked and that was diversity/variety. With that being said I hope we covered some things up here.
Arachnid: Couldn't have said it better, let's end this battle before Sombra hacks our Next time on DEATH BATTLE.
Scorpio: No matter how hard he tried, The Spy just couldn't lift his spirits.
Arachnid: The Winner is Sombra!
Sombra (Winner)
+Faster
+Could Ultimately Hack Most of Spy's Equipment
+Opportunist Could Reveal Spy's position
+Much more Diverse Arsenal
+More Technological Experience
+Battlefield Advantage
+SMG > Revolver
+Could Hack most of Spy's Arsenal leaving him vulnerable
+Translocation gave her a boost (+Faster while invisible)
=Both were on par with Experience and Hand-to-Hand Combat
-Only slightly more Arrogant
-Sapper could leave her vulnerable
The Spy (Loser)
+Stronger
+Just as Durable
+Sapper could do some major damage on Sombra
+Dead Ringer could help him evade a fatal blow
+Cunning and Manipulative
=Both were on par with Experience and Hand-to-Hand Combat
-Slower by a large margin
-Hacking would disable most of his best equipment (+EMP)
-Unlike Sombra, cannot see her cloaked
-Disguises wouldn't help him in the long run
-Invisibility could just be countered by Opportunist
-Was outclassed nearly everywhere else
NEXT TIME ON DEATH BATTLE!
Talon Secret Base, Epilogue
Within the blackness of a screen, a shadowy figure laid stranding at the monitor, with a forced grunt he began to walk away with his dark mass following on not too far away behind him. Not too far away, a young woman with mild purple skin was leaning against a wall with a fixed frown on her face, then with a French accent of her own she spoke "So, she made it out alive?" she wondered staring at the figure who stopped to communicate with her "Yeah... she did. Although she has a long way to go... to impress someone like me." with a tut the woman spoke once more "All those years of training and you still haven't given a second thought" she pondered waving a hand behind her long ponytail.
"She was only lucky from winning against that enemy... consider it beginners luck in a new field." He flared with her continuing on "You forget that she is an invaluable source to our team, without her we'd surely perish." trying to talk reason into the ignorant shadowed person "She is only a pawn to us like we are as well and to them added." he responded giving a clenched fist in his gesture and throwing his arm to the side which unaffected the woman in purple "You are always one to be superstitious, why now?" she wondered in a deadpan tone.
The figure only gave a tut with his voice growing more annoyed "You still don't get it, do you?" giving off an edged look underneath his cowl "Before we sent her on that mission I for one found out something... ghastly on her files that I looked through." he spoke her eyes narrowed with curiosity "Strange for one like yourself to find something terrifying." she pondered with his shadowy aura blazing off around him "Nothing ever gets past me, no man, nor machine, but that thing in the files she researched even made myself flinch." he continued on.
"Throughout America there have been towns turned barren and mutilated due to a unknown force, hundreds of the victims with lacerations, thousands with stabbings and tens of thousands killed in ways even one like myself wouldn't want to describe, but they all link back to being associated with fire." he carried on with a darkened voice "Another is that there have been monstrous readings of sound frequencies located in the co-ordinates 47°9'S 126°43'W in the southern Pacific Ocean and scientists say that they're growing even louder." then he began finishing off the last of the statements "Finally, strange anomalies located in a Small Town within Japan have revealed a strange case of murders and missing bodies all trailing behind one man.
The woman gave a more interested look as the figure turned around and made a few steps forward turning his head around "They say that all of these events might be connected with something far greater than we can imagine, then if that's the case everyone here at Talon have to be prepared for the worse and that's saying something." then the lady removed herself from her stance and stood normally "So, there was a reason why we sent her to pick up that data." she started to walk toward the cloaked figure now with a look of neutrality on her face.
"Yes, there was." he put bluntly "With that Intel we can gather more about what's going on in this world and what we can to elude these threats..." he growled with once more clenching a fist which caused the woman to stop in her tracks minding her distance "So, with that information we'll be able to preview any anomalies before they strike, sounds like something you and your colleague used to work wi-" he sentence was cut off short with a sharp turn around of the figure in black who dashed close to her face with it unchanging "We do not speak of him, only I get the rights to." he hissed before calming down and beginning to make his way for the next room.
"What's said is said, with that data it is invaluable to our mission... at all costs." making his way down the corridor with the door closing behind him the woman only gave a sigh before turning her attention to the monitor with her heels clicking towards the large computer and as the screen turned back on she began typing away at the keys looking through different files showing many more reported cases across the globe that not even Reaper mentioned himself, skimming across her attention was turned to an all new location that spiked from a strange place from the globe which put a state of confusion on her face with the light reflecting on her purple skin. Clicking on the file, this new location interested her from the sheer name alone.
"New Meridan...?" she spoke to herself clicking into the file to reveal more, looking at the information she read as it said "Strange reported case of a small girl with strange powers changing location around the state and heading it's way for the Canopy Kingdom." this put a look of interest on her deadpan looking face as she began looking more into it and revealed a strange name written at the bottom reading it aloud "Civilians call It: The Skullgirl" before pausing.
It was then that the entire room around her went black.
Literature
The Spy Vs Widowmaker - DEATH BATTLE!
Yang Xiao Long: Alright, combatants are all set and the stage is ready, let's end this debate once and for all!
Guts: It's time for a Death Battle.
-_O_-
King's Row: England
The night was cloudy, barely illuminated by bright street lights that lined the roads below. The buildings were dark, very few lights shining out from the building. All around the usually bustling town felt...dead. Why was this? Well, more than likely because of the multiple killed police, and the supposed death of the famous Peace Maker: Mondatta.
Who was responsible for all these deaths? What cold blooded fiend could do such a thing to innocent civilians and public f
Literature
DEATH BATTLE - Tracer VS Epic Scout - Fight
Alright, the combatants are set, let’s end this debate once and for all. It’s time for a DEATH BATTLE!
_______________________(Epic Line Break)__________________________________
“Who da hell capped da point?!” Scout exclaimed to himself as he ran as fast as he could towards the centre control point of Sawmill. Once he reached it, he saw someone vaguely familiar standing upon it, the body of a dead BLU Medic at her feet. Tracer turned to see Scout looking at her before steeling her expression.
“I finally found you! This guy didn’t seem to remember me, but you look like you do!” Tracer exclaimed, poi
Literature
Sombra hacks into DEATH BATTLE!
"If you hold the information, you hold all the cards."
-Real Name: ░░░░░░ (Goes by "Sombra")
-Age: 30
-Base of Operation: Dorado, Mexico
-Affiliation: Talon, Los Muertos (formerly)
-Well-known for her iconic "Boop"
-Had one of the longest ARG's to date
FEATS
-Able to take on multiple guards with little effort
-Held one of the most challenging ARG's by hacking multiple sites
-Throughout her life, had hacked and manipulated countless citizens and companies
-Speed can be comparable to Tracer's in-game
-Apparently is so stealthy that Soldier-76 couldn't get a visual on her location
-Alongside Talon operati
Suggested Collections
Featured in Groups
blizzardcrossoverfightfightingliteraturesombravalvewritingscrewattackteamfortress2team_fortress_2deathbattlespyteamfortress2teamfortress2spytf2spydeath_battledeathbattleideasdeathbattlescrewattackscrewattackdeathbattledeathbattlecommunitydeathbattlefanfictiondeathbattlesuggestionsoverwatchgameblizzardoverwatchoverwatchblizzardoverwatchreaperoverwatchwidowmakerscrewattackdeathbattlesoverwatch_widowmakerdeathbattlebiowidowmaker_overwatchoverwatch_reaperreaper_overwatchsombraoverwatchdeathbattledeviantartsombra_overwatchsombraboop
Team Fortress 2 vs. Overwatch!
Masters of Disguise, Sleuths of Stealth and Rockers of Accents, it's all for nothing when these two Hidden Fighters rat each other out in the arena! Will The Spy's cunning and master of invisibility be able to toggle with Sombra's hacking and intellect?! Only the one who stays undetected will triumph!
7,000+ words, I don't even know how I did it all then, but I did.
Yes, that was pretty quick. .
Sorry if things feel a bit pulled out too early but I just couldn't resist.
Also Megazord vs. Voltron had me adamant releasing it.
But now that it's out I feel a lot more relaxed.
Now, what to do next...?
The Spy, Team Fortress 2 (C) Valve
Sombra, Overwatch (C) Blizzard
Some Dead Joke, Here (C) Me
SPECIAL THANKS TIME!
Thanks to for helping me with the conclusion (Alongside some others)
And Thank You for all reading my works so far! It's really an honor!
I OWN NOTHING!
Masters of Disguise, Sleuths of Stealth and Rockers of Accents, it's all for nothing when these two Hidden Fighters rat each other out in the arena! Will The Spy's cunning and master of invisibility be able to toggle with Sombra's hacking and intellect?! Only the one who stays undetected will triumph!
7,000+ words, I don't even know how I did it all then, but I did.
Yes, that was pretty quick. .
Sorry if things feel a bit pulled out too early but I just couldn't resist.
Also Megazord vs. Voltron had me adamant releasing it.
But now that it's out I feel a lot more relaxed.
Now, what to do next...?
The Spy, Team Fortress 2 (C) Valve
Sombra, Overwatch (C) Blizzard
Some Dead Joke, Here (C) Me
SPECIAL THANKS TIME!
Thanks to for helping me with the conclusion (Alongside some others)
And Thank You for all reading my works so far! It's really an honor!
I OWN NOTHING!
© 2017 - 2024 Arachnid-le-Spider
Comments33
Join the community to add your comment. Already a deviant? Log In
spy: 80%
sombra: 19%
sombra: 19%